PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.15G143500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family G2-like
Protein Properties Length: 408aa    MW: 45382.5 Da    PI: 6.5222
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.15G143500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.99.3e-33263318156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Manes.15G143500.1.p 263 KQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 318
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.115260320IPR017930Myb domain
SuperFamilySSF466891.87E-18260321IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-30261322IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-27263318IPR006447Myb domain, plants
PfamPF002496.4E-8265316IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSVPPDLSL DFRPTYVPKT ISDFLKEVSL IGDVSEKVSK LDGFVKGLEE EMNKIDAFKR  60
ELPLCMLLLN DAILFLKAES IQYAASNNPP ILEEFIPLKK NCDDDDDDDE QDGRINKEKD  120
SRDKKNWMSS VQLWNTNDHP STNYIFDKKQ SLKLESKITK RGNQYEKEDT FQVCNSRSAA  180
RAFMPFKTYS GLSRNDDNDN NSNGELPVPG LSLLTPGIKN FREESSSTSS RISCSRAVSS  240
SAPNPHSNLQ NGPQPHQQQT ARKQRRCWSP ELHRRFVNAL QQLGGSQAAT PKQIRELMQV  300
DGLTNDEVKS HLQKYRLHTR RMPPATAASA NQSVVVLGGL WMSKDQYGDS MKATSSQSGS  360
PQGPLQFAGN TGGTSTTGGD SMEDDEDAKS EGYSWKSHIH RSVKDDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072452.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A067L2E90.0A0A067L2E9_JATCU; Uncharacterized protein
STRINGPOPTR_0004s15220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.22e-56G2-like family protein